BLAST HMMER InterPro
| Similar sequences |
Similarity Score |
| MADNKYGVINEVGDLGLGFQELNDNDQKVLQEQLKQEQDKDKK |
0.930 |
The hyperlinks BLASTp, HMMER or InterPro, will redirect you to their respective webpage and autofill the queried sequence in the query box of the respective tool.
The non-redundant protein database and blastp algorithm will be auto-selected in the BLAST service.
The PDB database will be autoselected in the HMMER service.
BLASTp - Fast local similarity search tool for protein sequence databases.
HMMER - Fast sensitive protein homology searches using profile hidden Markov models (HMMs) for querying against both sequence and HMM target databases.
InterPro - InterPro provides functional analysis of proteins by classifying them into families and predicting domains and important sites.